| Primary information |
|---|
| ID | 10436 |
| Uniprot ID | P11159 |
| Description | PBAN-type neuropeptides precursor [Cleaved into- - Diapause hormone homolog(DH); Alpha-SG neuropeptide; Beta-SG neuropeptide; Pheromonebiosynthesis-activating neuropeptide (HeZ-PBAN); Gamma-SGneuropeptide]. |
| Organism | Heliothis zea |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Heliothinae; Helicoverpa. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the pyrokinin family. |
| Tissue Specificity | Expressed in the suboesophageal ganglions. Not found in corpora cardiaca; corpora allata and thoracic ganglia |
| Post Translational Modification | NA |
| Function | PBAN is an hormone that controls sex pheromone production in female moths and pheromone responsiveness in male. PBAN also mediates visceral muscle contractile activity (myotropic activity). |
| Length | 194 |
| Molecular Weight | 22373 |
| Name | Pheromone biosynthesis-activating neuropeptide |
| Sequence | LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL |
| Sequence map | 33 (127-159) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|