| Primary information |
|---|
| ID | 10424 |
| Uniprot ID | P09971 |
| Description | PBAN-type neuropeptides precursor [Cleaved into- - Diapause hormone (DH);Alpha-SG neuropeptide (Alpha-SGNP); Beta-SG neuropeptide (Beta-SGNP);Pheromone biosynthesis-activating neuropeptide I (PBAN-I) (BoM-PBAN)(Melanization and reddish coloration hormone I) (MRCH-I); Pheromonebiosynthesis-activating |
| Organism | Bombyx mori |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the pyrokinin family. |
| Tissue Specificity | Suboesophageal ganglion |
| Post Translational Modification | NA |
| Function | PBAN is an hormone that controls sex pheromone production in female moths. PBAN also mediates visceral muscle contractile activity (myotropic activity). PBAN is identical to MRCH which is implicated in the formation of both melanin in the cuticle and ommochrome in the epidermis of armyworm species |
| Length | 192 |
| Molecular Weight | 22326 |
| Name | Pheromone biosynthesis-activating neuropeptide II |
| Sequence | RLSEDMPATPADQEMYQPDPEEMESRTRYFSPRL |
| Sequence map | 34 (125-158) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|