| Primary information |
|---|
| ID | 10399 |
| Uniprot ID | O76818 |
| Description | PBAN-type neuropeptides precursor [Cleaved into- - Diapause hormone homolog(DH); Alpha-SG neuropeptide; Beta-SG neuropeptide; Pheromonebiosynthesis-activating neuropeptide (AgI-PBAN); Gamma-SGneuropeptide]. |
| Organism | Agrotis ipsilon |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Noctuinae; Agrotis. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the pyrokinin family. |
| Tissue Specificity | Expressed in the mandibular; maxillary and labial neuromeres of the male and female brain-suboesophageal ganglions; in the corpora cardiaca and all around the corpora allata; and at a lower level in t |
| Post Translational Modification | NA |
| Function | PBAN is an hormone that controls sex pheromone production in female moths and pheromone responsiveness in male. PBAN also mediates visceral muscle contractile activity (myotropic activity) |
| Length | 193 |
| Molecular Weight | 22014 |
| Name | Pheromone biosynthesis-activating neuropeptide |
| Sequence | LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL |
| Sequence map | 33 (126-158) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|