Primary information |
---|
ID | 10399 |
Uniprot ID | O76818 |
Description | PBAN-type neuropeptides precursor [Cleaved into- - Diapause hormone homolog(DH); Alpha-SG neuropeptide; Beta-SG neuropeptide; Pheromonebiosynthesis-activating neuropeptide (AgI-PBAN); Gamma-SGneuropeptide]. |
Organism | Agrotis ipsilon |
Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Noctuinae; Agrotis. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the pyrokinin family. |
Tissue Specificity | Expressed in the mandibular; maxillary and labial neuromeres of the male and female brain-suboesophageal ganglions; in the corpora cardiaca and all around the corpora allata; and at a lower level in t |
Post Translational Modification | NA |
Function | PBAN is an hormone that controls sex pheromone production in female moths and pheromone responsiveness in male. PBAN also mediates visceral muscle contractile activity (myotropic activity) |
Length | 193 |
Molecular Weight | 22014 |
Name | Pheromone biosynthesis-activating neuropeptide |
Sequence | LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL |
Sequence map | 33 (126-158) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|