| Primary information |
|---|
| ID | 10394 |
| Uniprot ID | O45027 |
| Description | PBAN-type neuropeptides precursor [Cleaved into- - Diapause hormone homolog(DH); Alpha-SG neuropeptide (MAB-alpha-NP); Beta-SG neuropeptide (MAB-beta-NP); Pheromone biosynthesis-activating neuropeptide (MaB-PBAN);Gamma-SG neuropeptide (MAB-gamma-NP)] (Fragment). |
| Organism | Mamestra brassicae |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea;Noctuidae; Hadeninae; Mamestra. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the pyrokinin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | PBAN is an hormone that controls sex pheromone production in female moths and pheromone responsiveness in male. PBAN also mediates visceral muscle contractile activity (myotropic activity) |
| Length | 155 |
| Molecular Weight | 18096 |
| Name | Pheromone biosynthesis-activating neuropeptide |
| Sequence | LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL |
| Sequence map | 33 (88-120) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|