| Primary information |
|---|
| ID | 10359 |
| Uniprot ID | Q9PTS1 |
| Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
| Organism | Carassius auratus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
| Length | 162 |
| Molecular Weight | 18418 |
| Name | Corticoliberin |
| Sequence | SEEPPISLDLTFHLLREVLEMARAEQMAQQAHSNRKMMEIF |
| Sequence map | 41 (120-160) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q49MT7;Q49MT8 |
| Domain | NA |
| Pharmaceutical Use | NA
|