| Primary information |
|---|
| ID | 10343 |
| Uniprot ID | Q925Q5 |
| Description | Glycoprotein hormone alpha-2 precursor (Thyrostimulin subunit alpha). |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Stimulates the thyroid. Binds and activates THSR; leads to increased cAMP production |
| Length | 128 |
| Molecular Weight | 14030 |
| Name | Glycoprotein hormone alpha-2 |
| Sequence | HSPETAIPGCHLHPFNVTVRSDRLGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSSSQCCTISSLRKVRVWLQCVGNQRGELEIFTARACQCDMCRFSRY |
| Sequence map | 108 (21-128) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P47750 |
| Domain | NA |
| Pharmaceutical Use | NA
|