| Primary information |
|---|
| ID | 10342 |
| Uniprot ID | Q925Q4 |
| Description | Glycoprotein hormone alpha-2 precursor (Thyrostimulin subunit alpha). |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Stimulates the thyroid. Binds and activates THSR; leads to increased cAMP production |
| Length | 130 |
| Molecular Weight | 14199 |
| Name | Glycoprotein hormone alpha-2 |
| Sequence | LEAAVPIPGCHLHPFNVTVRSDRHGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISSLKKVRVWLHCVGNQRGELEIFTARACQCDMCRLSRY |
| Sequence map | 108 (23-130) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P21463 |
| Domain | NA |
| Pharmaceutical Use | NA
|