| Primary information |
|---|
| ID | 10324 |
| Uniprot ID | Q28632 |
| Description | Prolactin precursor (PRL). |
| Organism | Oryctolagus cuniculus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha; Leporidae;Oryctolagus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Prolactin acts primarily on the mammary gland by promoting lactation |
| Length | 227 |
| Molecular Weight | 25990 |
| Name | Prolactin |
| Sequence | LPICPSGAVNCQVSLRDLFDRAVILSHHIHKLSSEMFNEFDKRYTQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNMVLRVLPSWNDPLYHLVTEVRGMQEAPDAILSKAIEIEEQNRRLLEGMEKIVGQVHPGIKENEIYSVWSGLPSLQMADEDARLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
| Sequence map | 199 (29-227) |
| PDB ID | 1AN3 |
| Drugpedia | NA |
| Receptor | P14787 |
| Domain | NA |
| Pharmaceutical Use | NA
|