| Primary information |
|---|
| ID | 10315 |
| Uniprot ID | Q04618 |
| Description | Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Cleaved into- - NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropi |
| Organism | Oncorhynchus mykiss |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular Location | NA |
| Developmental Stage | Expressed only in sexually active fish. |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | Pituitary and hypothalamus of adult diploid animals |
| Post Translational Modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
| Function | NA |
| Length | 240 |
| Molecular Weight | 26719 |
| Name | Corticotropin |
| Sequence | SYSMEHFRWGKPIGHKRRPIKVYASSLEGGDSSEGTFPLQA |
| Sequence map | 41 (112-152) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q6QLQ0;Q6QLQ1 |
| Domain | NA |
| Pharmaceutical Use | NA
|