Primary information |
---|
ID | 10313 |
Uniprot ID | Q04617 |
Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Cleaved into- - NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropi |
Organism | Oncorhynchus mykiss |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular Location | Secreted |
Developmental Stage | Expressed in sexually active or inactive fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals; and hypothalamus of triploid and ovulated female trout |
Post Translational Modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | NA |
Length | 253 |
Molecular Weight | 28559 |
Name | Beta-endorphin 1 |
Sequence | YGGFMKSWDERSQKPLLTLFKNVIIKDGQQ |
Sequence map | 30 (199-228) |
PDB ID | NA |
Drugpedia | NA |
Receptor | Q6QLQ0;Q6QLQ1 |
Domain | NA |
Pharmaceutical Use | NA
|