| Primary information |
|---|
| ID | 10309 |
| Uniprot ID | Q04617 |
| Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Cleaved into- - NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropi |
| Organism | Oncorhynchus mykiss |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed in sexually active or inactive fish. |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | Pituitary and hypothalamus of adult diploid animals; and hypothalamus of triploid and ovulated female trout |
| Post Translational Modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
| Function | NA |
| Length | 253 |
| Molecular Weight | 28559 |
| Name | Corticotropin |
| Sequence | SYSMEHFRWGKPVGRKRRPVKVYTNGVEEESSEAFPSEM |
| Sequence map | 39 (104-142) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q6QLQ0;Q6QLQ1 |
| Domain | NA |
| Pharmaceutical Use | NA
|