| Primary information |
|---|
| ID | 10294 |
| Uniprot ID | Q64171 |
| Description | Prorelaxin precursor [Cleaved into- - Relaxin B chain; Relaxin A chain]. |
| Organism | Mesocricetus auratus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Cricetidae; Cricetinae; Mesocricetus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. It bears mature young; and allows separation of the pelvic bones |
| Length | 177 |
| Molecular Weight | 20007 |
| Name | Relaxin B chain |
| Sequence | RVTKEWLDEVIHVCGREYVRAILDICAATVGLEAPPL |
| Sequence map | 37 (23-59) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|