| Primary information |
|---|
| ID | 10284 |
| Uniprot ID | P80345 |
| Description | Cholecystokinins precursor (CCK) [Cleaved into- - Cholecystokinin 58(CCK58); Cholecystokinin 40 (CCK40); Cholecystokinin 33 (CCK33);Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)]. |
| Organism | Trachemys scripta |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Testudinoidea; Emydidae; Trachemys. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | Expressed in brain; duodenum and small intestine |
| Post Translational Modification | NA |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear |
| Length | 130 |
| Molecular Weight | 14603 |
| Name | Cholecystokinin-33 |
| Sequence | GPTGRISMMGNRVQNIDPTHRINDRDYMGWMDF |
| Sequence map | 33 (86-118) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|