| Primary information |
|---|
| ID | 10274 |
| Uniprot ID | Q9PRR0 |
| Description | Somatostatin precursor [Cleaved into- - Somatostatin-35; Somatostatin-14](Fragment). |
| Organism | Lampetra fluviatilis |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Lampetra. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the somatostatin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Somatostatin inhibits the release of somatotropin |
| Length | 35 |
| Molecular Weight | 3584 |
| Name | Somatostatin-35 |
| Sequence | AAAAPGAAGGAQLPLGNRERKAGCKNFFWKTFSSC |
| Sequence map | 35 (1-35) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|