| Primary information |
|---|
| ID | 10260 |
| Uniprot ID | P09686 |
| Description | Glucagon precursor [Cleaved into- - Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide] (Fragment). |
| Organism | Myoxocephalus scorpius |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Scorpaeniformes;Cottoidei; Cottidae; Myoxocephalus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | NA |
| Length | 96 |
| Molecular Weight | 10755 |
| Name | Glucagon-like peptide |
| Sequence | HADGTFTSDVSSYLNDQAIKDFVAKLKSGKV |
| Sequence map | 31 (66-96) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|