| Primary information |
|---|
| ID | 10255 |
| Uniprot ID | Q9PUR0 |
| Description | Glucagon-2 precursor [Cleaved into- - Glucagon-2 (Glucagon II) (Glu II);Glucagon-like peptide 2-II (GLP-2II)]. |
| Organism | Petromyzon marinus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | NA |
| Length | 120 |
| Molecular Weight | 13397 |
| Name | Glucagon-like peptide 2-II |
| Sequence | HSDGSFTNDMNVMLDRMSAKNFLEWLKQQGRG |
| Sequence map | 32 (89-120) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|