| Primary information |
|---|
| ID | 10249 |
| Uniprot ID | Q9PUR1 |
| Description | Glucagon-1 precursor [Cleaved into- - Glucagon-1 (Glucagon I); Glucagon-likepeptide 1-I (GLP-1I); Glucagon-like peptide 2-I (GLP-2I)]. |
| Organism | Petromyzon marinus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Promotes hydrolysis of glycogen and lipids; and raises the blood sugar level |
| Length | 160 |
| Molecular Weight | 18042 |
| Name | Glucagon-like peptide 1-I |
| Sequence | HADGTFTNDMTSYLDAKAARDFVSWLARSDKS |
| Sequence map | 32 (82-113) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|