| Primary information |
|---|
| ID | 10244 |
| Uniprot ID | Q9I954 |
| Description | Thymosin beta-b. |
| Organism | Cyprinus carpio |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
| Subcellular Location | Cytoplasm |
| Developmental Stage | NA |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Length | 43 |
| Molecular Weight | 4970 |
| Name | Thymosin beta-b |
| Sequence | ADKPDISEVSQFDKTKLKKTETQEKNTLPTKETIEQEKQCEA |
| Sequence map | 42 (2-43) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|