| Primary information |
|---|
| ID | 10231 |
| Uniprot ID | Q9N0V5 |
| Description | Calcitonin precursor. |
| Organism | Equus caballus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
| Length | 140 |
| Molecular Weight | 15358 |
| Name | Calcitonin |
| Sequence | CSNLSTCVLGTYTQDLNKFHTFPQTAIGVGAP |
| Sequence map | 32 (84-115) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|