| Primary information |
|---|
| ID | 10209 |
| Uniprot ID | Q9PS36 |
| Description | Follitropin subunit beta (Follicle-stimulating hormone beta subunit)(FSH-beta) (FSH-B) (Follitropin beta chain). |
| Organism | Rana catesbeiana |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Stimulates development of follicle and spermatogenesis in the reproductive organs |
| Length | 107 |
| Molecular Weight | 11794 |
| Name | Follicle-stimulating hormone beta subunit |
| Sequence | CELSNITIVLEKEECGACVSVNATWCSGYCYTKDANLMYPQKSEKQGVCTYTEVIYETVKIPGCAENVNPFYTYPVAVDCHCGRCDSETTDCTVRALGPTYCSLSQD |
| Sequence map | 107 (1-107) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|