Primary information |
---|
ID | 10167 |
Uniprot ID | P83627 |
Description | Vitellogenesis-inhibiting hormone (VIH). |
Organism | Armadillidium vulgare |
Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Peracarida; Isopoda; Oniscidea; Armadillidiidae;Armadillidium. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | Found in the sinus glands of both male and female. Found also in the brain; the neuroendocrine structures of the protocerebrum |
Post Translational Modification | NA |
Function | Inhibits secondary vitellogenesis in females. Has no hyperglycemic or molt-inhibiting activity |
Length | 83 |
Molecular Weight | 9491 |
Name | Vitellogenesis-inhibiting hormone |
Sequence | YNIPLGWGRRDMPGCLGVLGNRDLYDDVSRICSDCQNVFRDKNVESKCRSDCFSTSYFETCIMALDLAEKISDYKLHASILKE |
Sequence map | 83 (1-83) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|