| Primary information |
|---|
| ID | 10167 |
| Uniprot ID | P83627 |
| Description | Vitellogenesis-inhibiting hormone (VIH). |
| Organism | Armadillidium vulgare |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Peracarida; Isopoda; Oniscidea; Armadillidiidae;Armadillidium. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Found in the sinus glands of both male and female. Found also in the brain; the neuroendocrine structures of the protocerebrum |
| Post Translational Modification | NA |
| Function | Inhibits secondary vitellogenesis in females. Has no hyperglycemic or molt-inhibiting activity |
| Length | 83 |
| Molecular Weight | 9491 |
| Name | Vitellogenesis-inhibiting hormone |
| Sequence | YNIPLGWGRRDMPGCLGVLGNRDLYDDVSRICSDCQNVFRDKNVESKCRSDCFSTSYFETCIMALDLAEKISDYKLHASILKE |
| Sequence map | 83 (1-83) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|