| Primary information |
|---|
| ID | 10152 |
| Uniprot ID | Q01283 |
| Description | Somatotropin precursor (Growth hormone). |
| Organism | Lates calcarifer |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Latidae; Lates. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Length | 204 |
| Molecular Weight | 23100 |
| Name | Somatotropin |
| Sequence | QPITDSQRLFSIAVSRVQHLHLLAQRRFSEFESSLQTEEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYRLVESWEFSSRSLSGGSAPRDQISPKLSELKTGILLLIRANQDGAEMFSDSSALQLAPYGNYYQSLGADESLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL |
| Sequence map | 187 (18-204) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|