| Primary information |
|---|
| ID | 10131 |
| Uniprot ID | Q10987 |
| Description | Molt-inhibiting hormone precursor (MIH) (Fragment). |
| Organism | Procambarus bouvieri |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Procambarus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted A molting cycle is initiated when MIH secretion diminishes or stops |
| Length | 74 |
| Molecular Weight | 8530 |
| Name | Molt-inhibiting hormone |
| Sequence | QVFDQACKGIYDRAIFKKLELVCDDCYNLYRKPKVATTCRENCYANSVFRQCLDDLLLINVVDEYISGVQIV |
| Sequence map | 72 (1-72) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|