| Primary information |
|---|
| ID | 10129 |
| Uniprot ID | P83220 |
| Description | Probable molt-inhibiting hormone (MIH). |
| Organism | Jasus lalandii |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Palinura;Palinuroidea; Palinuridae; Jasus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted A molting cycle is initiated when MIH secretion diminishes or stops. Has little or no hyperglycemic activity |
| Length | 74 |
| Molecular Weight | 9013 |
| Name | Probable molt-inhibiting hormone |
| Sequence | RFTFDCPGMMGQRYLYEQVEQVCDDCYNLYREEKIAVNCRENCFLNSWFTVCLQATMREHETPRFDIWRSILKA |
| Sequence map | 74 (1-74) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|