| Primary information |
|---|
| ID | 10117 |
| Uniprot ID | P80665 |
| Description | Glycoprotein hormones alpha chain (Anterior pituitary glycoproteinhormones common subunit alpha) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain)(Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropin alphachain) (Thyroid-stimulating hormone |
| Organism | Struthio camelus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | NA |
| Length | 96 |
| Molecular Weight | 10782 |
| Name | Glycoprotein hormones alpha chain |
| Sequence | FPDGEFLMQGCPECKLGENRFFSKPGAPVYQCTGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKAFTKITLKDNVKIENHTECHCSTCYYHKS |
| Sequence map | 96 (1-96) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|