| Primary information |
|---|
| ID | 10105 |
| Uniprot ID | P82373 |
| Description | Diuretic hormone class 1 (Diuretic hormone class I) (Diuretic peptide)(DP) (DH(46)). |
| Organism | Diploptera punctata |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Orthopteroidea; Dictyoptera; Blattaria; Blaberidae;Diplopterinae; Diploptera. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules. Has a greater effect on the transport of Na(+) then K(+) ions. In vitro; has synergistic effects with the smaller diuretic hormone DH(31) which co-occurs with it |
| Length | 46 |
| Molecular Weight | 5322 |
| Name | Diuretic hormone class 1 |
| Sequence | TGTGPSLSIVNPLDVLRQRLLLEIARRRMRQTQNMIQANRDFLESI |
| Sequence map | 46 (1-46) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|