Primary information |
---|
ID | 10105 |
Uniprot ID | P82373 |
Description | Diuretic hormone class 1 (Diuretic hormone class I) (Diuretic peptide)(DP) (DH(46)). |
Organism | Diploptera punctata |
Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Orthopteroidea; Dictyoptera; Blattaria; Blaberidae;Diplopterinae; Diploptera. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules. Has a greater effect on the transport of Na(+) then K(+) ions. In vitro; has synergistic effects with the smaller diuretic hormone DH(31) which co-occurs with it |
Length | 46 |
Molecular Weight | 5322 |
Name | Diuretic hormone class 1 |
Sequence | TGTGPSLSIVNPLDVLRQRLLLEIARRRMRQTQNMIQANRDFLESI |
Sequence map | 46 (1-46) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|