Primary information |
---|
ID | 10104 |
Uniprot ID | P82015 |
Description | Diuretic hormone 2 (DH-2) (Diuretic peptide 2) (DP-2) (DH(30)). |
Organism | Hyles lineata |
Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Macroglossinae; Hyles. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Regulation of fluid secretion. May stimulate primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules |
Length | 30 |
Molecular Weight | 3575 |
Name | Diuretic hormone 2 |
Sequence | SFSVNPAVEILQHRYMEKVAQNNRNFLNRV |
Sequence map | 30 (1-30) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|