| Primary information |
|---|
| ID | 10104 |
| Uniprot ID | P82015 |
| Description | Diuretic hormone 2 (DH-2) (Diuretic peptide 2) (DP-2) (DH(30)). |
| Organism | Hyles lineata |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Macroglossinae; Hyles. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Regulation of fluid secretion. May stimulate primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules |
| Length | 30 |
| Molecular Weight | 3575 |
| Name | Diuretic hormone 2 |
| Sequence | SFSVNPAVEILQHRYMEKVAQNNRNFLNRV |
| Sequence map | 30 (1-30) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|