Primary information |
---|
ID | 10099 |
Uniprot ID | P83800 |
Description | Crustacean hyperglycemic hormone (CHH). |
Organism | Astacus fluviatilis |
Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Astacidae; Astacus. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
Post Translational Modification | NA |
Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
Length | 72 |
Molecular Weight | 8409 |
Name | Crustacean hyperglycemic hormone |
Sequence | QVFDQACKGIYDRAIFKKLDRVCDDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVVDEYISGVQIV |
Sequence map | 72 (1-72) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|