| Primary information |
|---|
| ID | 10098 |
| Uniprot ID | Q25154 |
| Description | Crustacean hyperglycemic hormones isoform B precursor [Cleaved into- - CHHprecursor-related peptide B (CPRP-B); Crustacean hyperglycemic hormoneB (CHH-B)]. |
| Organism | Homarus americanus |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Nephropoidea; Nephropidae; Homarus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Present also in the ventral nervous system |
| Post Translational Modification | Stereoinversion of L-Phe (form CHH-B-I) to D-Phe (form CHH-B- II). |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Length | 134 |
| Molecular Weight | 15050 |
| Name | Crustacean hyperglycemic hormone B |
| Sequence | QVFDQACKGVYDRNLFKKLNRVCEDCYNLYRKPFIVTTCRENCYSNRVFRQCLDDLLLSDVIDEYVSNVQMV |
| Sequence map | 72 (61-132) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|