| Primary information |
|---|
| ID | 10096 |
| Uniprot ID | P83485 |
| Description | Crustacean hyperglycemic hormone A (CHHA). |
| Organism | Cherax destructor |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Parastacoidea; Parastacidae; Cherax. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | NA |
| Post Translational Modification | Stereoinversion of L-Phe (in CHHA-I) to D-Phe (in CHHA-II). |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Length | 72 |
| Molecular Weight | 8375 |
| Name | Crustacean hyperglycemic hormone A |
| Sequence | QVFDQACKGVYDRAIFKKLDRVCDDCYNLYRKPYVAVSCRGNCYNNLVFRQCLEELFLGNGFNEYISGVQTV |
| Sequence map | 72 (1-72) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|