| Primary information |
|---|
| ID | 10094 |
| Uniprot ID | Q9U5D2 |
| Description | Crustacean hyperglycemic hormones 2 precursor (Pej-SGP-II) [Cleaved into- -CHH precursor-related peptide 2 (CPRP 2); Crustacean hyperglycemichormone 2 (CHH 2)]. |
| Organism | Penaeus japonicus |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Length | 120 |
| Molecular Weight | 13467 |
| Name | Crustacean hyperglycemic hormone 2 |
| Sequence | SLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVAMECRSNCYNNPVFRQCMEYLLPAHLHDEYRLAVQMV |
| Sequence map | 72 (47-118) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|