| Primary information |
|---|
| ID | 10060 |
| Uniprot ID | Q7M3C4 |
| Description | Relaxin B chain. |
| Organism | Phocoenoides dalli dalli |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Odontoceti; Phocoenidae; Phocoenoides. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
| Length | 31 |
| Molecular Weight | 3538 |
| Name | Relaxin B chain |
| Sequence | QRTNDFIKACGRELVRVWVEICGSVSWGRTA |
| Sequence map | 31 (1-31) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|