| Primary information |
|---|
| ID | 10057 |
| Uniprot ID | Q27IM2 |
| Description | Parathyroid hormone precursor (Parathyrin) (PTH). |
| Organism | Equus caballus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the parathyroid hormone family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion |
| Length | 115 |
| Molecular Weight | 13062 |
| Name | Parathyroid hormone (Parathyrin) (PTH) |
| Sequence | SVSEIQLMHNLGKHLNSVERVEWLRKKLQDVHNFIALGAPIFHRDGGSQRPRKKEDNVLIESHQKSLGEADKADVDVLSKTKSQ |
| Sequence map | 84 (32-115) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|