| Primary information |
|---|
| ID | 10037 |
| Uniprot ID | P80594 |
| Description | Egg-laying-like hormone (L-ELH). |
| Organism | Theromyzon tessulatum |
| Txonomy | Eukaryota; Metazoa; Annelida; Clitellata; Hirudinida; Hirudinea;Rhynchobdellida; Glossiphoniidae; Theromyzon. |
| Subcellular Location | NA |
| Developmental Stage | L-ELH greatly increases before egg-laying; while it strongly decreases after egg-laying. |
| Similarity | NA |
| Tissue Specificity | Supra; subesophageal ganglia and segmental ganglia of the ventral nerve cord and brain |
| Post Translational Modification | NA |
| Function | May be involved in leech reproduction |
| Length | 36 |
| Molecular Weight | 4290 |
| Name | Egg-laying-like hormone |
| Sequence | GSGVSNGGTEMIQLSHIRERQRYWAQDNLRRRFLEK |
| Sequence map | 36 (1-36) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|