| Primary information |
|---|
| ID | 10030 |
| Uniprot ID | P18918 |
| Description | Prolactin-2C4 precursor (Proliferin-3) (Mitogen-regulated protein 3). |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | May have a role in embryonic development. It is likely to provide a growth stimulus to target cells in maternal and fetal tissues during the development of the embryo at mid-gestation |
| Length | 224 |
| Molecular Weight | 25338 |
| Name | Prolactin-2C4 |
| Sequence | FPMCAMRNGRCFMSFEDTFELAGSLSHNISIEVSELFNEFEKHYSNVSGLRDKSPMRCNTSFLPTPENKEQARLTHYAALLKSGAMILDAWESPLDDLVSELSTIKNVPDIIISKATDIKKKINAVRNGVNALMSTMLQNGDEEKKNPAWFLQSDNEDARIHSLYGMISCLDNDFKKVDIYLNVLKCYMLKIDNC |
| Sequence map | 195 (30-224) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q08501 |
| Domain | NA |
| Pharmaceutical Use | NA
|