| Primary information |
|---|
| ID | 10028 |
| Uniprot ID | P01197 |
| Description | Corticotropin (Adrenocorticotropic hormone) (ACTH) [Cleaved into- -Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP)]. |
| Organism | Squalus acanthias |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Squaliformes; Squaloidei;Squalidae; Squalus. |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | ACTH stimulates the adrenal glands to release cortisol |
| Length | 39 |
| Molecular Weight | 4686 |
| Name | Corticotropin |
| Sequence | SYSMEHFRWGKPMGRKRRPIKVYPNSFEDESVENMGPEL |
| Sequence map | 1 (1-39) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q6Q488 |
| Domain | NA |
| Pharmaceutical Use | NA
|