| Primary information |
|---|
| ID | 10025 |
| Uniprot ID | P48098 |
| Description | Peptide YY-like precursor (PYY). |
| Organism | Lampetra fluviatilis |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Lampetra. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | Gut and medial reticulospinal neuron system in the brainstem |
| Post Translational Modification | NA |
| Function | Gastrointestinal hormone and neuropeptide |
| Length | 93 |
| Molecular Weight | 10551 |
| Name | Peptide YY-like |
| Sequence | FPPKPDNPGDNASPEQMARYKAAVRHYINLITRQRY |
| Sequence map | 36 (28-63) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|