| Primary information |
|---|
| ID | 10011 |
| Uniprot ID | P56618 |
| Description | Diuretic hormone 1 (Diuretic hormone I) (DH I) (Diuretic peptide I)(DP I) (DH(37)) (DH37). |
| Organism | Tenebrio molitor |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Coleoptera; Polyphaga; Cucujiformia;Tenebrionidae; Tenebrio. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Stimulates fluid secretion by the Malpighian tubules. Increases cyclic AMP production |
| Length | 37 |
| Molecular Weight | 4371 |
| Name | Diuretic hormone 1 |
| Sequence | SPTISITAPIDVLRKTWEQERARKQMVKNREFLNSLN |
| Sequence map | 37 (1-37) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|