| Primary information |
|---|
| ID | 10009 |
| Uniprot ID | P09682 |
| Description | Glucagon. |
| Organism | Hydrolagus colliei |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Chimaeridae; Hydrolagus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Produced by the X-cells of the islets of pancreas |
| Post Translational Modification | NA |
| Function | Promotes hydrolysis of glycogen and lipids; and raises the blood sugar level |
| Length | 36 |
| Molecular Weight | 4236 |
| Name | Glucagon |
| Sequence | HTDGIFSSDYSKYLDNRRTKDFVQWLLSTKRNGANT |
| Sequence map | 36 (1-36) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|