| Primary information |
|---|
| ID | 10005 |
| Uniprot ID | P81278 |
| Description | Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Cleaved into- - Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20]. |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Widely expressed; with highest levels in medulla oblongata and hypothalamus |
| Post Translational Modification | NA |
| Function | Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL |
| Length | 83 |
| Molecular Weight | 9215 |
| Name | Prolactin-releasing peptide PrRP31 |
| Sequence | SRAHQHSMETRTPDINPAWYTGRGIRPVGRF |
| Sequence map | 31 (22-52) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q64121 |
| Domain | NA |
| Pharmaceutical Use | NA
|