A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 11299 |
| Swiss-prot Accession number | P01215 (Sequence in FASTA format) |
| Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha)(Choriogonadotropin alpha chain) (Chorionic gonadotrophin alphasubunit) (CG-alpha). |
| Source organism | Homo sapiens (Human) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 116 Amino acids |
| Molecular weight | 13075 |
| References | 1 PubMed abstract 481597 2 PubMed abstract 8196184 3 PubMed abstract 15489334 4 PubMed abstract 6286817 5 PubMed abstract 7462224 6 PubMed abstract 890569 7 PubMed abstract 5065401 8 Keutmann H.T., Williams R.M., Bishop W.H., Ryan R.J.; "Structure of human luteninizing hormone."; Fed. Proc. 37:1828-1828(1978). 9 PubMed abstract 1158880 10 PubMed abstract 4835135 11 PubMed abstract 1150658 12 PubMed abstract 4745444 13 PubMed abstract 6774759 14 PubMed abstract 7410374 15 PubMed abstract 1991473 16 PubMed abstract 8202136 17 PubMed abstract 8898911 18 PubMed abstract 15662415 19 PubMed abstract 481597 20 PubMed abstract 8196184 21 PubMed abstract 15489334 22 PubMed abstract 6286817 23 PubMed abstract 7462224 24 PubMed abstract 890569 25 PubMed abstract 5065401 26 Keutmann H.T., Williams R.M., Bishop W.H., Ryan R.J.; "Structure of human luteninizing hormone."; Fed. Proc. 37:1828-1828(1978). 27 PubMed abstract 1158880 28 PubMed abstract 4835135 29 PubMed abstract 1150658 30 PubMed abstract 4745444 31 PubMed abstract 6774759 32 PubMed abstract 7410374 33 PubMed abstract 1991473 34 PubMed abstract 8202136 35 PubMed abstract 8898911 36 PubMed abstract 15662415 |
| Domain Name | Hormone_6 |
| Hormone Name | Glycoprotein hormones alpha chain |
| Mature Hormone Sequence | APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| Position of mature hormone in Pre-Hormone protein | 92 Residues from position (25-116) |
| Receptor | P23945 Detail in HMRbase P22888 Detail in HMRbase P16473 Detail in HMRbase |
| Gene ID | 1081 |
| PDB ID | 1DZ7 1E9J 1FL7 1HCN 1HD4 1HRP 1QFW 1XUL 1XWD |
| Drugpedia | wiki |
| Comments |