Primary information |
---|
CancerPDF_ID | CancerPDF_ID9712 |
PMID | 21533267 |
Peptide Sequence | SYKMADEAGSEADHEGTHSTKRGHAKSRPV |
Peptide Sequence in Publication | SYKMADEAGSEADHEGTHSTKRGHAKSRPV |
Protein Name | Fibrinogen alpha chain |
UniprotKB Entry Name | FIBA_HUMAN |
Biofluid | Serum |
M/Z | 814.61 |
Charge | 4 |
Mass/H+ | NA |
Mass (in Daltons) | NA |
Profiling Technique | LC-MS |
Peptide Identification Technique | LC/MS/MS |
Quantification Technique | Multiple Reaction Monitoring |
Labeling | Label Free |
FDR | 1.49 |
p-Value | NA |
Software | MASCOT |
Length of Peptide | 30 |
Cancer Type | Lung adenocarcinoma |
Database for Peptide search | Swissprot Database (57.4) |
Modification | Oxidation |
Number of Patients | 62 lung adenocarcinoma and 30 healthy control |
Regulation/Differential Expression | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" |
Validation | MRM-based validation of 19 candidates |
Sensitivity | NA |
Specificity | NA |
Accuracy | NA |
Secondary information |
---|
Peptide Atlas | NA |
IEDB | |