| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID9710 |
| PMID | 21533267 |
| Peptide Sequence | SYKMADEAGSEADHEGTHSTKRGHAKSRPV |
| Peptide Sequence in Publication | SYKMADEAGSEADHEGTHSTKRGHAKSRPV |
| Protein Name | Fibrinogen alpha chain |
| UniprotKB Entry Name | FIBA_HUMAN |
| Biofluid | Serum |
| M/Z | 810.62 |
| Charge | 4 |
| Mass/H+ | NA |
| Mass (in Daltons) | NA |
| Profiling Technique | LC-MS |
| Peptide Identification Technique | LC/MS/MS |
| Quantification Technique | Multiple Reaction Monitoring |
| Labeling | Label Free |
| FDR | 1.49 |
| p-Value | NA |
| Software | MASCOT |
| Length of Peptide | 30 |
| Cancer Type | Lung adenocarcinoma |
| Database for Peptide search | Swissprot Database (57.4) |
| Modification | NA |
| Number of Patients | 62 lung adenocarcinoma and 30 healthy control |
| Regulation/Differential Expression | "Differentially expressed between earlier-stage lung cancer group (stage-I, II, and IIIa) vs normal" |
| Validation | MRM-based validation of 19 candidates |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Secondary information |
|---|
| Peptide Atlas | NA |
| IEDB | |