Primary information |
---|
CancerPDF_ID | CancerPDF_ID7865 |
PMID | 24982608 |
Peptide Sequence | VLALLKTPAQFDADELRAAMKGLGTDEDTL |
Peptide Sequence in Publication | VLALLKTPAQFDADELRAAMKGLGTDEDTL |
Protein Name | Annexin A1 |
UniprotKB Entry Name | ANXA1_HUMAN |
Biofluid | Urine |
M/Z | NA |
Charge | NA |
Mass/H+ | NA |
Mass (in Daltons) | NA |
Profiling Technique | Nano-LC-MS |
Peptide Identification Technique | MS/MS |
Quantification Technique | NA |
Labeling | Label Free |
FDR | 0.01 |
p-Value | NA |
Software | "GPM search engine, MASCOT" |
Length of Peptide | 30 |
Cancer Type | Ovarian cancer |
Database for Peptide search | IPI 3.71 Human Database  |
Modification | NA |
Number of Patients | 6 Ovarian cancer patients and 6 normal individuals |
Regulation/Differential Expression | Uniquely present in case of urine of ovarian cancer patients |
Validation | NA |
Sensitivity | NA |
Specificity | NA |
Accuracy | NA |
Secondary information |
---|
Peptide Atlas | NA |
IEDB | |