| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID7669 |
| PMID | 24982608 |
| Peptide Sequence | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV |
| Peptide Sequence in Publication | TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV |
| Protein Name | IGHat protein |
| UniprotKB Entry Name | A2N192_HUMAN |
| Biofluid | Urine |
| M/Z | NA |
| Charge | NA |
| Mass/H+ | NA |
| Mass (in Daltons) | NA |
| Profiling Technique | Nano-LC-MS |
| Peptide Identification Technique | MS/MS |
| Quantification Technique | NA |
| Labeling | Label Free |
| FDR | 0.01 |
| p-Value | NA |
| Software | "GPM search engine, MASCOT" |
| Length of Peptide | 32 |
| Cancer Type | Ovarian cancer |
| Database for Peptide search | IPI 3.71 Human Database  |
| Modification | NA |
| Number of Patients | 6 Ovarian cancer patients and 6 normal individuals |
| Regulation/Differential Expression | Uniquely present in case of urine of ovarian cancer patients |
| Validation | NA |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Secondary information |
|---|
| Peptide Atlas | NA |
| IEDB | |