Primary information |
---|
CancerPDF_ID | CancerPDF_ID557 |
PMID | 19795908 |
Peptide Sequence | SYKMADEAGSEADHEGTHSTKRGHAKSRPV |
Peptide Sequence in Publication | SYKMADEAGSEADHEGTHSTKRGHAKSRPV |
Protein Name | Fibrinogen alpha chain |
UniprotKB Entry Name | FIBA_HUMAN |
Biofluid | Plasma |
M/Z | 1080.51 |
Charge | 3 |
Mass/H+ | NA |
Mass (in Daltons) | NA |
Profiling Technique | LC-MS |
Peptide Identification Technique | MALDI-TOF/TOF |
Quantification Technique | LC-MRM (multiple reaction monitoring) |
Labeling | Labelled |
FDR | less than 7% |
p-Value | NA |
Software | FlexAnalysis 3.0 and Biotools 3.0 software |
Length of Peptide | 30 |
Cancer Type | Ductal adenocarcinoma of the pancreas (DAP) |
Database for Peptide search | NCBI refseq Protein Database |
Modification | NA |
Number of Patients | "42 normal, 28patients" |
Regulation/Differential Expression | NA |
Validation | NA |
Sensitivity | NA |
Specificity | NA |
Accuracy | NA |
Secondary information |
---|
Peptide Atlas | NA |
IEDB | |