| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID1288 |
| PMID | 21136997 |
| Peptide Sequence | GKSSSYSKQFTSSTSYNRGDSTFESKSYKMA |
| Peptide Sequence in Publication | GKSSSYSKQFTSSTSYNRGDSTFESKSYKMA |
| Protein Name | Fibrinogen alpha |
| UniprotKB Entry Name | FIBA_HUMAN |
| Biofluid | Serum |
| M/Z | 3445.57323 |
| Charge | 1 |
| Mass/H+ | NA |
| Mass (in Daltons) | NA |
| Profiling Technique | LC-MS |
| Peptide Identification Technique | LC-MS-MS/MS |
| Quantification Technique | LC-ESI-MS |
| Labeling | Label Free |
| FDR | NA |
| p-Value | NA |
| Software | MASCOT(v. 2.2.01) |
| Length of Peptide | 31 |
| Cancer Type | Colorectal cancer |
| Database for Peptide search | SwissProt Database |
| Modification | NA |
| Number of Patients | 30 patients and 30 healthy controls |
| Regulation/Differential Expression | NA |
| Validation | Leave One out Cross validation |
| Sensitivity | NA |
| Specificity | NA |
| Accuracy | NA |
| Secondary information |
|---|
| Peptide Atlas | NA |
| IEDB | |