Primary information |
---|
CancerPDF_ID | CancerPDF_ID10966 |
PMID | 21805675 |
Peptide Sequence | AVGPPGFAGEKGPSGEAGTAGPPGTPGPQG |
Peptide Sequence in Publication | G.AVGPPGFAGEKGPSGEAGTAGPPGTPGPQG.L |
Protein Name | Collagen alpha-2(I) chain |
UniprotKB Entry Name | CO1A2_HUMAN |
Biofluid | Urine |
M/Z | 2650.2165 |
Charge | NA |
Mass/H+ | NA |
Mass (in Daltons) | NA |
Profiling Technique | MALDI-TOF |
Peptide Identification Technique | MALDI-TOF-MS |
Quantification Technique | NA |
Labeling | Label Free |
FDR | 1 |
p-Value | NA |
Software | NA |
Length of Peptide | 30 |
Cancer Type | Muscle-invasive bladder cancer |
Database for Peptide search | SwissProt Database |
Modification | "Oxidation: 4, 26, 28" |
Number of Patients | 751 bladder cancer and 127 control |
Regulation/Differential Expression | Differentially expressed between cancer vs normal samples |
Validation | Mann-Whitney tests and areas under receiver-operator characteristic |
Sensitivity | NA |
Specificity | NA |
Accuracy | NA |
Secondary information |
---|
Peptide Atlas | NA |
IEDB | |