Primary information |
---|
sequence ID | Seq_7905 |
Peptide sequence | SVVETDYDQYALLYSQGSKGPGEDFRMATL |
CancerPDF_ID | CancerPDF_ID7197, CancerPDF_ID7198, |
PMID | 24982608,24982608 |
Protein Name | Prostaglandin D2 synthase 21kDa,Prostaglandin-H2 D-isomerase |
UniprotKB Entry Name | A0A024R8G3_HUMAN,PTGDS_HUMAN |
Fluid | Urine,Urine |
M/Z | NA,NA |
Charge | NA,NA |
Mass (in Da) | NA,NA |
fdr | NA,NA |
Profiling Technique | Nano-LC-MS,Nano-LC-MS |
Peptide Identification technique | MS/MS,MS/MS |
Quantification Technique | NA,NA |
Labelled/Label Free | Label Free,Label Free |
FDR | 0.01,0.01 |
CancerPDF_ID | CancerPDF_ID7197, CancerPDF_ID7198, |
p-Value | NA,NA |
Software | "GPM search engine, MASCOT","GPM search engine, MASCOT" |
Length | 30,30 |
Cancer Type | Ovarian cancer,Ovarian cancer |
Database | IPI 3.71 Human Database ,IPI 3.71 Human Database |
Modification | NA,NA |
Number of Patients | 6 Ovarian cancer patients and 6 normal individuals,6 Ovarian cancer patients and 6 normal individuals |
Regulation | Uniquely present in case of urine of ovarian cancer patients,Uniquely present in case of urine of ovarian cancer patients |
Validation | NA,NA |
Sensitivity | NA,NA |
Specificity | NA,NA |
Accuracy | NA,NA |
Peptide Atlas | NA |
IEDB | |