Primary information |
---|
sequence ID | Seq_7851 |
Peptide sequence | SVLGQLGITKVFSNGADLSGVTEEAPLKLS |
CancerPDF_ID | CancerPDF_ID1620, CancerPDF_ID2847, |
PMID | 21136997,21136997 |
Protein Name | Alpha-1 protease inhibitor,Alpha-1 protease inhibitor |
UniprotKB Entry Name | NA,NA |
Fluid | Serum,Plasma |
M/Z | 3029.62848,3029.6285 |
Charge | 1,1 |
Mass (in Da) | NA,NA |
fdr | NA,NA |
Profiling Technique | LC-MS,LC-MS |
Peptide Identification technique | LC-MS-MS/MS,LC-MS-MS/MS |
Quantification Technique | LC-ESI-MS,LC-ESI-MS |
Labelled/Label Free | Label Free,Label Free |
FDR | NA,NA |
CancerPDF_ID | CancerPDF_ID1620, CancerPDF_ID2847, |
p-Value | NA,NA |
Software | MASCOT(v. 2.2.01),MASCOT(v. 2.2.01) |
Length | 30,30 |
Cancer Type | Colorectal cancer,Normal |
Database | SwissProt Database,SwissProt Database |
Modification | NA,NA |
Number of Patients | 30 patients and 30 healthy controls,27 healthy individuals |
Regulation | NA,NA |
Validation | Leave One out Cross validation,Leave One out Cross validation |
Sensitivity | NA,NA |
Specificity | NA,NA |
Accuracy | NA,NA |
Peptide Atlas | PeptideAtlas |
IEDB | |